(data stored in ACNUC7421 zone)

EMBL: CP001389.PE98

CP001389.PE98        Location/Qualifiers
FT   CDS             complement(107866..108180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23902"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF65"
FT                   /protein_id="ACP23902.1"
FT                   /translation="MTSALSPHHDFDCQSCGACCAYSAEWPRFSLETEEELEQIPADHV
FT                   AADLGGMRCENDRCTALEGTLGKFVACKVYAVRPIVCRTCMPGDDECLMARQRLFGAAA
FT                   "
     MTSALSPHHD FDCQSCGACC AYSAEWPRFS LETEEELEQI PADHVAADLG GMRCENDRCT        60
     ALEGTLGKFV ACKVYAVRPI VCRTCMPGDD ECLMARQRLF GAAA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page