(data stored in ACNUC7421 zone)

EMBL: CP001389.PHOB

CP001389.PHOB        Location/Qualifiers
FT   CDS             169361..170044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="NGR_c01490"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23951"
FT                   /db_xref="GOA:C3MFB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB4"
FT                   /protein_id="ACP23951.1"
FT                   /translation="MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQER
FT                   LPDLLILDWMLPGVSGIELCRRLRQRPETERLPIIMLTARGEESERVRGLATGADDYVV
FT                   KPFSTPELMARVKAMLRRAKPEVLSTVLRCGDIELDRETHRVHRRSREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMPDVIRTVRGAG
FT                   YSLES"
     MLPKIAVVED EEALSVLLRY NLEAEGFEVD TILRGDEAEI RLQERLPDLL ILDWMLPGVS        60
     GIELCRRLRQ RPETERLPII MLTARGEESE RVRGLATGAD DYVVKPFSTP ELMARVKAML       120
     RRAKPEVLST VLRCGDIELD RETHRVHRRS REVRLGPTEF RLLEFLMSSP GRVFSRSQLL       180
     DGVWGHDIYV DERTVDVHVG RLRKALNFSN MPDVIRTVRG AGYSLES                     227
//

If you have problems or comments...

PBIL Back to PBIL home page