(data stored in ACNUC7421 zone)

EMBL: CP001389.PHOH

CP001389.PHOH        Location/Qualifiers
FT   CDS             44670..45725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="NGR_c00420"
FT                   /product="phosphate starvation inducible family protein
FT                   PhoH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23846"
FT                   /db_xref="GOA:C3MF09"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF09"
FT                   /protein_id="ACP23846.1"
FT                   /translation="MNGHEMISSSSRHSKTTATDANHFVLTFENNRFASELFGQFDQNL
FT                   KLLEERLRVDARPRGNSVAISGDVVATNQARRALDYLYGRLQSGASIDTSDVEGAIRMA
FT                   VAADDQLQLPTMERKAKLTMAQISTRKKTIAARTPMQDAYIRAMERSELVFGVGPAGTG
FT                   KTYLAVAHAAQLLERGAVDRIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDM
FT                   MPGDKVERAISAGVIEIAPLAFMRGRTLANAAVILDEAQNTTSMQMKMFLTRLGENGRM
FT                   IVTGDPSQVDLPRGVKSGLVEALQILKGVEGVSVIRFKDADVVRHPMVARIVRAYESHT
FT                   AVHDESEQSDR"
     MNGHEMISSS SRHSKTTATD ANHFVLTFEN NRFASELFGQ FDQNLKLLEE RLRVDARPRG        60
     NSVAISGDVV ATNQARRALD YLYGRLQSGA SIDTSDVEGA IRMAVAADDQ LQLPTMERKA       120
     KLTMAQISTR KKTIAARTPM QDAYIRAMER SELVFGVGPA GTGKTYLAVA HAAQLLERGA       180
     VDRIILSRPA VEAGERLGFL PGDMKEKVDP YLRPLYDALY DMMPGDKVER AISAGVIEIA       240
     PLAFMRGRTL ANAAVILDEA QNTTSMQMKM FLTRLGENGR MIVTGDPSQV DLPRGVKSGL       300
     VEALQILKGV EGVSVIRFKD ADVVRHPMVA RIVRAYESHT AVHDESEQSD R                351
//

If you have problems or comments...

PBIL Back to PBIL home page