(data stored in ACNUC7421 zone)

EMBL: CP001389.PHOU

CP001389.PHOU        Location/Qualifiers
FT   CDS             168597..169313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="NGR_c01480"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23950"
FT                   /db_xref="GOA:C3MFB3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB3"
FT                   /protein_id="ACP23950.1"
FT                   /translation="MMSHPHITTAFDEELKYLTRRISEMGGQAEQMVADSVRALVNSDL
FT                   ALAQKVISDDAILDDAERQIGEKAIVTIAKRQPMAADLREIMGSIRIAADLERVGDLGK
FT                   NTAKRVIAVAGSGIPRKLARGLEHLAELALIQLKEVLDVYASRSPEKANSIRERDEEID
FT                   AIYTSLFRELLTYMMEDPRNITPCTHLLFCAKNIERIGDHATNIAETIYYMATGAQPQG
FT                   ERPKDDMTSTLGSVTD"
     MMSHPHITTA FDEELKYLTR RISEMGGQAE QMVADSVRAL VNSDLALAQK VISDDAILDD        60
     AERQIGEKAI VTIAKRQPMA ADLREIMGSI RIAADLERVG DLGKNTAKRV IAVAGSGIPR       120
     KLARGLEHLA ELALIQLKEV LDVYASRSPE KANSIRERDE EIDAIYTSLF RELLTYMMED       180
     PRNITPCTHL LFCAKNIERI GDHATNIAET IYYMATGAQP QGERPKDDMT STLGSVTD         238
//

If you have problems or comments...

PBIL Back to PBIL home page