(data stored in ACNUC7421 zone)

EMBL: CP001389.POTH

CP001389.POTH        Location/Qualifiers
FT   CDS             372725..373636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="NGR_c03300"
FT                   /product="putrescine ABC transport system permease protein
FT                   PotH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24128"
FT                   /db_xref="GOA:C3MGL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL3"
FT                   /protein_id="ACP24128.1"
FT                   /translation="MAKLASALVSRLVIIVPYAWLLFFFLIPFFIVFRISLSQTAVAMP
FT                   PYTPVFDLAGGLAGLLEKAREFSVDNYVWLTDDALYFNAYVSSLVIAAISTFLTLLIGF
FT                   PVAYGMAKAPRSIRPTLLMLVILPFWTSFLIRVYAWIAILKPEGLLNQFLITIGIIDQP
FT                   LIILNTNTAIYIGIVYSYLPFMVLPIYSALEKMDNALIEAAQDLGCTPTSAFWRVTFPL
FT                   SLPGVIAGCLLVFIPAVGEFVIPDLLGGSETLMIGKTLWNEFNANRDWPVSSAVAIILL
FT                   MILVIPIVYFQNVQGKADSEGK"
     MAKLASALVS RLVIIVPYAW LLFFFLIPFF IVFRISLSQT AVAMPPYTPV FDLAGGLAGL        60
     LEKAREFSVD NYVWLTDDAL YFNAYVSSLV IAAISTFLTL LIGFPVAYGM AKAPRSIRPT       120
     LLMLVILPFW TSFLIRVYAW IAILKPEGLL NQFLITIGII DQPLIILNTN TAIYIGIVYS       180
     YLPFMVLPIY SALEKMDNAL IEAAQDLGCT PTSAFWRVTF PLSLPGVIAG CLLVFIPAVG       240
     EFVIPDLLGG SETLMIGKTL WNEFNANRDW PVSSAVAIIL LMILVIPIVY FQNVQGKADS       300
     EGK                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page