(data stored in ACNUC7421 zone)

EMBL: CP001389.POTI

CP001389.POTI        Location/Qualifiers
FT   CDS             373640..374461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="NGR_c03310"
FT                   /product="putrescine ABC transporter system permease
FT                   protein PotI"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24129"
FT                   /db_xref="GOA:C3MGL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL4"
FT                   /protein_id="ACP24129.1"
FT                   /translation="MEKWSRFNVASVVLGFGFLYLPIVLLVIFSFNESKLVTVWAGFST
FT                   KWYSQLWHNQGLLDAAWVTIRVGLLSATCATVLGTLAAIALVRYSRFRGRVLFSGMVYA
FT                   PLVMPEVITGLSLLLLFVAIGLDRGFWTITLAHITFTMCFVAVVVQSRLLSFDQSIEEA
FT                   ALDLGATPVRTFFAITLPVIAPAVFSGWVLAFTLSLDDLVISSFTTGPGATTLPMKIYS
FT                   QVRLGVTPEINAICTILIGVVALGVVVASIVTKRREVQRERDERAAIAAIG"
     MEKWSRFNVA SVVLGFGFLY LPIVLLVIFS FNESKLVTVW AGFSTKWYSQ LWHNQGLLDA        60
     AWVTIRVGLL SATCATVLGT LAAIALVRYS RFRGRVLFSG MVYAPLVMPE VITGLSLLLL       120
     FVAIGLDRGF WTITLAHITF TMCFVAVVVQ SRLLSFDQSI EEAALDLGAT PVRTFFAITL       180
     PVIAPAVFSG WVLAFTLSLD DLVISSFTTG PGATTLPMKI YSQVRLGVTP EINAICTILI       240
     GVVALGVVVA SIVTKRREVQ RERDERAAIA AIG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page