(data stored in ACNUC7421 zone)

EMBL: CP001389.PUTA1

CP001389.PUTA1       Location/Qualifiers
FT   CDS             complement(103970..107677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA1"
FT                   /locus_tag="NGR_c00980"
FT                   /product="bifunctional PutA protein; includes: Proline
FT                   dehydrogenase; Delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23901"
FT                   /db_xref="GOA:C3MF64"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF64"
FT                   /protein_id="ACP23901.1"
FT                   /translation="MSQTQLQKPTISTDAAPAPFADFAPPIRTQTTLRQAITAAYRRPE
FT                   TECLPPLVEAATLPRGTRDAAAGTARKLVEALRAKHKGSGVEGLVQEYSLSSQEGVALM
FT                   CLAEALLRIPDTATRDALIRDKISDGNWKSHLGGGRSLFVNAATWGLVVTGKLTSTVND
FT                   RSLAAALTRLISRCGEPVIRRGVDMAMRMMGEQFVTGETIDEALRRARALEQKGFRYSY
FT                   DMLGEAATTAADAERYYKDYEAAIHAIGKASAGRGIYEGPGISIKLSALHPRYARTQAA
FT                   RVMGELLPKVKALALLAKTYDIGFNIDAEEADRLELSLDLLEELCLDSDLADWNGMGFV
FT                   VQAYGKRCPFVLDFIIDLARRAGRRIMVRLVKGAYWDAEIKRAQLDGLEDFPVFTRKIH
FT                   TDVSYIACARKLLSATDAVFPQFATHNAQTLATIHHMAGKDFHVGKYEFQCLHGMGEPL
FT                   YEEVVGRENLGRPCRIYAPVGTHETLLAYLVRRLLENGANSSFVHRIADPGVSIDALIA
FT                   DPVEIVRAMPVVGAKHEKIALPAELFGAARPNSAGLDISNEATLAALTETLKASAAIGW
FT                   TAAPQLATGAASGETRPVVNPGDHRDRVGSVTETSEEDAKRAVRLAAEAAPSWAAVSPA
FT                   ERAACLDRAADLMQARMPTLLGLIVREAGKSLLNAIAEVREAIDFLRYYAEQTRRTLGQ
FT                   AHRPLGPVICISPWNFPLAIFTGQIAAALVAGNPVLAKPAEETPLIAAEGVRILHEAGV
FT                   PASALQLLPGDGRVGAALVAAPQTAGVMFTGSTEVARLIQAQLADRLSPAGRPIPLIAE
FT                   TGGQNAMIVDSSALAEQVVGDVIASAFDSAGQRCSALRVLCLQEDIADRTLAMLKGALH
FT                   ELNIGRTDRLSVDVGPVISAEAKDIIETHIERMRGLGRKVEQIGLAAETEAGTFVPPTI
FT                   IELEKLADLQREVFGPVLHVIRYRRDNLDRLIDDINATGYGLTFGLHTRLDETIAHVTS
FT                   RIKAGNLYVNRNIIGAVVGVQPFGGRGLSGTGPKAGGPLYLGRLVTPAPVPPQHSSVHI
FT                   DPTLLDFAKWLDGKGATAEAETARNAGSSSALGLDLELPGPVGERNLYALHPRGRVLLV
FT                   PATESGLYHQLAAALATGNSVVVDAACGLQASLKSLPHSVALRVSWSKDWAADGPFAGA
FT                   LVEGDAERIRQVNKAIAALPGPLVLVQAASGEEIARNPDAYCLNWLVEEVSTSINTAAA
FT                   GGNASLMTIG"
     MSQTQLQKPT ISTDAAPAPF ADFAPPIRTQ TTLRQAITAA YRRPETECLP PLVEAATLPR        60
     GTRDAAAGTA RKLVEALRAK HKGSGVEGLV QEYSLSSQEG VALMCLAEAL LRIPDTATRD       120
     ALIRDKISDG NWKSHLGGGR SLFVNAATWG LVVTGKLTST VNDRSLAAAL TRLISRCGEP       180
     VIRRGVDMAM RMMGEQFVTG ETIDEALRRA RALEQKGFRY SYDMLGEAAT TAADAERYYK       240
     DYEAAIHAIG KASAGRGIYE GPGISIKLSA LHPRYARTQA ARVMGELLPK VKALALLAKT       300
     YDIGFNIDAE EADRLELSLD LLEELCLDSD LADWNGMGFV VQAYGKRCPF VLDFIIDLAR       360
     RAGRRIMVRL VKGAYWDAEI KRAQLDGLED FPVFTRKIHT DVSYIACARK LLSATDAVFP       420
     QFATHNAQTL ATIHHMAGKD FHVGKYEFQC LHGMGEPLYE EVVGRENLGR PCRIYAPVGT       480
     HETLLAYLVR RLLENGANSS FVHRIADPGV SIDALIADPV EIVRAMPVVG AKHEKIALPA       540
     ELFGAARPNS AGLDISNEAT LAALTETLKA SAAIGWTAAP QLATGAASGE TRPVVNPGDH       600
     RDRVGSVTET SEEDAKRAVR LAAEAAPSWA AVSPAERAAC LDRAADLMQA RMPTLLGLIV       660
     REAGKSLLNA IAEVREAIDF LRYYAEQTRR TLGQAHRPLG PVICISPWNF PLAIFTGQIA       720
     AALVAGNPVL AKPAEETPLI AAEGVRILHE AGVPASALQL LPGDGRVGAA LVAAPQTAGV       780
     MFTGSTEVAR LIQAQLADRL SPAGRPIPLI AETGGQNAMI VDSSALAEQV VGDVIASAFD       840
     SAGQRCSALR VLCLQEDIAD RTLAMLKGAL HELNIGRTDR LSVDVGPVIS AEAKDIIETH       900
     IERMRGLGRK VEQIGLAAET EAGTFVPPTI IELEKLADLQ REVFGPVLHV IRYRRDNLDR       960
     LIDDINATGY GLTFGLHTRL DETIAHVTSR IKAGNLYVNR NIIGAVVGVQ PFGGRGLSGT      1020
     GPKAGGPLYL GRLVTPAPVP PQHSSVHIDP TLLDFAKWLD GKGATAEAET ARNAGSSSAL      1080
     GLDLELPGPV GERNLYALHP RGRVLLVPAT ESGLYHQLAA ALATGNSVVV DAACGLQASL      1140
     KSLPHSVALR VSWSKDWAAD GPFAGALVEG DAERIRQVNK AIAALPGPLV LVQAASGEEI      1200
     ARNPDAYCLN WLVEEVSTSI NTAAAGGNAS LMTIG                                 1235
//

If you have problems or comments...

PBIL Back to PBIL home page