(data stored in ACNUC7421 zone)

EMBL: CP001389.RBSA2

CP001389.RBSA2       Location/Qualifiers
FT   CDS             287643..289154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA2"
FT                   /locus_tag="NGR_c02460"
FT                   /product="ribose import ATP-binding protein RbsA1"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24044"
FT                   /db_xref="GOA:C3MFZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ3"
FT                   /protein_id="ACP24044.1"
FT                   /translation="MKPAITLEGISKSFPGVRALSDVSLALYPGSVTALIGENGAGKST
FT                   LVKILTGIYQPDSGMIRVADTETTFPTALAAARAGVTAIHQETVLFDELSVAENIFLGH
FT                   APRNRFGLIDWKKLNADAAALLQRAGADFDPTIRLRDLGIAKKHLVAIARALSVDAQVV
FT                   IMDEPTAALSHKEIHELYALIERLKADGKAILFISHKFDEIFRIADRYTVFRDGTMVGE
FT                   GLIADASQDDLVRMMVGRAVDSVYPKKDVKIGEAVLTVSGYRHPTEFEDINFELRRGEI
FT                   LGFYGLVGAGRSEFMQSLIGITRPSAGAVRLDGNVLVIRNPAEAIRAGIVYVPEERGRQ
FT                   GAIIGMPIFQNVTLPSLSHTSRSGFLKLANEFALAREYTARLDLRAASLDQDVGTLSGG
FT                   NQQKVVIAKWLATKPKVIILDEPTKGIDIGSKAAVHAFMSELAAQGLSVIMVSSEIPEI
FT                   MGMSDRVIVMREGRIAGRFERSELTAEKLVRAAAGIETQINGRAA"
     MKPAITLEGI SKSFPGVRAL SDVSLALYPG SVTALIGENG AGKSTLVKIL TGIYQPDSGM        60
     IRVADTETTF PTALAAARAG VTAIHQETVL FDELSVAENI FLGHAPRNRF GLIDWKKLNA       120
     DAAALLQRAG ADFDPTIRLR DLGIAKKHLV AIARALSVDA QVVIMDEPTA ALSHKEIHEL       180
     YALIERLKAD GKAILFISHK FDEIFRIADR YTVFRDGTMV GEGLIADASQ DDLVRMMVGR       240
     AVDSVYPKKD VKIGEAVLTV SGYRHPTEFE DINFELRRGE ILGFYGLVGA GRSEFMQSLI       300
     GITRPSAGAV RLDGNVLVIR NPAEAIRAGI VYVPEERGRQ GAIIGMPIFQ NVTLPSLSHT       360
     SRSGFLKLAN EFALAREYTA RLDLRAASLD QDVGTLSGGN QQKVVIAKWL ATKPKVIILD       420
     EPTKGIDIGS KAAVHAFMSE LAAQGLSVIM VSSEIPEIMG MSDRVIVMRE GRIAGRFERS       480
     ELTAEKLVRA AAGIETQING RAA                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page