(data stored in ACNUC7421 zone)

EMBL: CP001389.RIBA

CP001389.RIBA        Location/Qualifiers
FT   CDS             577607..578707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="NGR_c05210"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24317"
FT                   /db_xref="GOA:C3MHI9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI9"
FT                   /protein_id="ACP24317.1"
FT                   /translation="MSYDQKRVVEAIRAFEAGEIVVVTDDGGRENEGDLIVAAVHCTSE
FT                   KMAFIVRHTSGIVCAPMPRDEAKRLNLNAMVAENDSAHTTAFTVSVDFKHGTTTGISAD
FT                   DRTLTVRNLANPNVGATDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCKLASLPPIGV
FT                   ICELVNDDGTVTRGPQVEAFAETHGLKQVSVADLIAYRQRKETLIEKANSFAIETAYGR
FT                   AKAHTYSLPWDPMQHLAVVFGDVRDGVDIPVRLHLENVGADVFGNDRQIDEIMKRIAGE
FT                   GRGVIVYLREGSVGVGVSQTARKGKHEREAHSEAQARESEWLEIGLGAQILKDLGITSI
FT                   RLLSSRERHYVGLEGFGIKIAATEIL"
     MSYDQKRVVE AIRAFEAGEI VVVTDDGGRE NEGDLIVAAV HCTSEKMAFI VRHTSGIVCA        60
     PMPRDEAKRL NLNAMVAEND SAHTTAFTVS VDFKHGTTTG ISADDRTLTV RNLANPNVGA       120
     TDFVRPGHIF PLVAREGGVL MRSGHTEAAV DLCKLASLPP IGVICELVND DGTVTRGPQV       180
     EAFAETHGLK QVSVADLIAY RQRKETLIEK ANSFAIETAY GRAKAHTYSL PWDPMQHLAV       240
     VFGDVRDGVD IPVRLHLENV GADVFGNDRQ IDEIMKRIAG EGRGVIVYLR EGSVGVGVSQ       300
     TARKGKHERE AHSEAQARES EWLEIGLGAQ ILKDLGITSI RLLSSRERHY VGLEGFGIKI       360
     AATEIL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page