(data stored in ACNUC7421 zone)

EMBL: CP001389.RIBF

CP001389.RIBF        Location/Qualifiers
FT   CDS             461570..462640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="NGR_c04130"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24209"
FT                   /db_xref="GOA:C3MGU4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU4"
FT                   /protein_id="ACP24209.1"
FT                   /translation="MTVFHRNETRDPLPERLHGGVIAIGNFDGVHRGHQSVLNRALDEA
FT                   KGRGVPALVLTFEPHPRTVFRPDQPVFRLTPAPLKARILEGMGFGAVIEYPFDRTFSEL
FT                   SASRFHPPHPARMAARLTCRHRFRFPFWQGAGRRSGLPDGGRLEGRLRRDAGGRLPRRE
FT                   RLRHFFELHPLLAGRRRCLACGRHARLSLHGRSGGDRRQEARAHPRLSDREHAPTAGSR
FT                   TPKRHLCGALPPSGRFSLRRRRKLRPPSDRRQRWRSAAGDLRLRLLRRSLRRGLRRLLL
FT                   WASARRAEIRRAGAFDGAYERGREGGACPSCRRSAFERDRPPDQFRLRWAREAVCWRKE
FT                   SRHAALADLFKRPKTP"
     MTVFHRNETR DPLPERLHGG VIAIGNFDGV HRGHQSVLNR ALDEAKGRGV PALVLTFEPH        60
     PRTVFRPDQP VFRLTPAPLK ARILEGMGFG AVIEYPFDRT FSELSASRFH PPHPARMAAR       120
     LTCRHRFRFP FWQGAGRRSG LPDGGRLEGR LRRDAGGRLP RRERLRHFFE LHPLLAGRRR       180
     CLACGRHARL SLHGRSGGDR RQEARAHPRL SDREHAPTAG SRTPKRHLCG ALPPSGRFSL       240
     RRRRKLRPPS DRRQRWRSAA GDLRLRLLRR SLRRGLRRLL LWASARRAEI RRAGAFDGAY       300
     ERGREGGACP SCRRSAFERD RPPDQFRLRW AREAVCWRKE SRHAALADLF KRPKTP           356
//

If you have problems or comments...

PBIL Back to PBIL home page