(data stored in ACNUC7421 zone)

EMBL: CP001389.RIMJ

CP001389.RIMJ        Location/Qualifiers
FT   CDS             complement(596277..596888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimJ"
FT                   /locus_tag="NGR_c05410"
FT                   /product="ribosomal-protein (S5)-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24337"
FT                   /db_xref="GOA:C3MHK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK9"
FT                   /protein_id="ACP24337.1"
FT                   /translation="MARSVFRFLSRQPESVEIANEDYLLRLPRYADYRQWYQLRSASRS
FT                   FLEPWEPSWRTDEMTESAFRGRVIRNEQEFASGQAVPLFLFHKHDEVLLGGLTIGHIRR
FT                   GAAQNCMIGYWMGQKYAGQGHMHAALQLTIPYIFSTLELHRIEAACIPENTRSIRLLEK
FT                   AGFEREGYLRQYLKINGQWRDHLMFSLLSADAVPSRNMPL"
     MARSVFRFLS RQPESVEIAN EDYLLRLPRY ADYRQWYQLR SASRSFLEPW EPSWRTDEMT        60
     ESAFRGRVIR NEQEFASGQA VPLFLFHKHD EVLLGGLTIG HIRRGAAQNC MIGYWMGQKY       120
     AGQGHMHAAL QLTIPYIFST LELHRIEAAC IPENTRSIRL LEKAGFEREG YLRQYLKING       180
     QWRDHLMFSL LSADAVPSRN MPL                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page