(data stored in ACNUC7421 zone)

EMBL: CP001389.RNPA

CP001389.RNPA        Location/Qualifiers
FT   CDS             complement(88738..89124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="NGR_c00830"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23887"
FT                   /db_xref="GOA:C3MF50"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF50"
FT                   /protein_id="ACP23887.1"
FT                   /translation="MTSEKDKSTVGRLKSRPQFLAVRAGEARKGPHFLLEVLDRKDPEG
FT                   EARVGFTVTKKHGNAVERNRMRRRLKEAVRLSAGFAMKPGHDYVIVARRDLLNAPFDAL
FT                   TRGLQDRIENKPKPKRPPAGSRKP"
     MTSEKDKSTV GRLKSRPQFL AVRAGEARKG PHFLLEVLDR KDPEGEARVG FTVTKKHGNA        60
     VERNRMRRRL KEAVRLSAGF AMKPGHDYVI VARRDLLNAP FDALTRGLQD RIENKPKPKR       120
     PPAGSRKP                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page