(data stored in ACNUC7421 zone)

EMBL: CP001389.SECD1

CP001389.SECD1       Location/Qualifiers
FT   CDS             225770..228307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD1"
FT                   /locus_tag="NGR_c02010"
FT                   /product="protein-export membrane protein SecD/SecF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24001"
FT                   /db_xref="GOA:C3MFV0"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV0"
FT                   /protein_id="ACP24001.1"
FT                   /translation="MRTSRWAVLAYVAIIIFGCLAAVPSVLTPAMREQFASVLPFKPVT
FT                   LGLDLRGGSHLVLEVDGAGLQKARLNSLLDDTRRVLRGERVSASSARISGNSVTVSVPD
FT                   PADREKVLPKLQELAAPVGGTAGFGGSAAEVDVATNGDVITLAMTEAGLADRMTKAVEQ
FT                   SLEIIRNRVDQVGVAEPLIQRIGSNRILVQLPGLQDPTRLRELLGSTAQMSFHMLDQTV
FT                   DITQPAPRGVDILPGADDGNKYPVESRVAISGERLEDAKVGFDQRTNQPVVDFAFDSLG
FT                   ARQFADITRENVGRPFAIVLDGKVLTAPVINEPILGGRGQISGNFTVEEATVLSALLRS
FT                   GALPAPLTIIEERSVGPNLGSDSIRMGLYTGLAGFGLVVTLMVVLYGAWGMIANVGLVL
FT                   HTIMTIGVLGLIGSTLTLPGIAGIILGIGMAVDANILINARIREETEAGAGAMKALDVG
FT                   FNKAYATILDSNVTTLAGTILLFWLGSGPVRGFAVTMMLGIIISMFTSVTVVRLLMREV
FT                   VVRRKMKKLEIPSLFGRVPHLPTFSFMKRRFQAIGFSAFLSISSVILFFTPGLNYGIDF
FT                   IGGIQVEAVSKDKIDLPTLRHSLEELNLGEVALQDFGGGQSVLVRVQRQPGGEQEQTAA
FT                   LNRIKDAVTTAIPGASMERTEVVGPTVSGELARSGFLAVGLAMVAILLYIWFRFEWHFA
FT                   VGAIAVLLLDITKTVGFFALTGIDFNLTAIAALLTMIGYSVNDKVVVYDRMRENLRKYK
FT                   SMPFSDLIDMSINQVIARCIFTSMATALSLVPMAIWGGEAVRSFAWPMIFGVIVATTSS
FT                   IYIGGPILLFLSRWWKDREAGRSSAQQPGTPAV"
     MRTSRWAVLA YVAIIIFGCL AAVPSVLTPA MREQFASVLP FKPVTLGLDL RGGSHLVLEV        60
     DGAGLQKARL NSLLDDTRRV LRGERVSASS ARISGNSVTV SVPDPADREK VLPKLQELAA       120
     PVGGTAGFGG SAAEVDVATN GDVITLAMTE AGLADRMTKA VEQSLEIIRN RVDQVGVAEP       180
     LIQRIGSNRI LVQLPGLQDP TRLRELLGST AQMSFHMLDQ TVDITQPAPR GVDILPGADD       240
     GNKYPVESRV AISGERLEDA KVGFDQRTNQ PVVDFAFDSL GARQFADITR ENVGRPFAIV       300
     LDGKVLTAPV INEPILGGRG QISGNFTVEE ATVLSALLRS GALPAPLTII EERSVGPNLG       360
     SDSIRMGLYT GLAGFGLVVT LMVVLYGAWG MIANVGLVLH TIMTIGVLGL IGSTLTLPGI       420
     AGIILGIGMA VDANILINAR IREETEAGAG AMKALDVGFN KAYATILDSN VTTLAGTILL       480
     FWLGSGPVRG FAVTMMLGII ISMFTSVTVV RLLMREVVVR RKMKKLEIPS LFGRVPHLPT       540
     FSFMKRRFQA IGFSAFLSIS SVILFFTPGL NYGIDFIGGI QVEAVSKDKI DLPTLRHSLE       600
     ELNLGEVALQ DFGGGQSVLV RVQRQPGGEQ EQTAALNRIK DAVTTAIPGA SMERTEVVGP       660
     TVSGELARSG FLAVGLAMVA ILLYIWFRFE WHFAVGAIAV LLLDITKTVG FFALTGIDFN       720
     LTAIAALLTM IGYSVNDKVV VYDRMRENLR KYKSMPFSDL IDMSINQVIA RCIFTSMATA       780
     LSLVPMAIWG GEAVRSFAWP MIFGVIVATT SSIYIGGPIL LFLSRWWKDR EAGRSSAQQP       840
     GTPAV                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page