(data stored in ACNUC7421 zone)

EMBL: CP001389.SPPA

CP001389.SPPA        Location/Qualifiers
FT   CDS             19002..19961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="NGR_c00210"
FT                   /product="signal peptide peptidase S49, SppA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23825"
FT                   /db_xref="GOA:C3MEK2"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK2"
FT                   /protein_id="ACP23825.1"
FT                   /translation="MDELAIADRRSLRRKLSFWRWTAAAILVLGGFALIAFSGWTEVSE
FT                   RAREHVARVTVSGVIQDDRELVERLERIADNKSAKALIVTISSPGGTTYGGEVLYKAIR
FT                   KVAAKKPVVSDVRTLAASAGYMIALAGDRIVAGETSITGSIGVIFQYPQVKQLMDKVGV
FT                   SLESIKSRPLKAEPSPFHPPSPEARAMIQTMIDDSYNWFVDLVAERRKLPRPEALALAD
FT                   GRIFTGRQALQGKLVDTIGGDDEIRAFLADRKVSKDLPVVDWEAPGGSFPFGLSTVVSN
FT                   WLKLLGYDAFPAMNGLEKIGGDKLFLDGLVSVWQVDAQ"
     MDELAIADRR SLRRKLSFWR WTAAAILVLG GFALIAFSGW TEVSERAREH VARVTVSGVI        60
     QDDRELVERL ERIADNKSAK ALIVTISSPG GTTYGGEVLY KAIRKVAAKK PVVSDVRTLA       120
     ASAGYMIALA GDRIVAGETS ITGSIGVIFQ YPQVKQLMDK VGVSLESIKS RPLKAEPSPF       180
     HPPSPEARAM IQTMIDDSYN WFVDLVAERR KLPRPEALAL ADGRIFTGRQ ALQGKLVDTI       240
     GGDDEIRAFL ADRKVSKDLP VVDWEAPGGS FPFGLSTVVS NWLKLLGYDA FPAMNGLEKI       300
     GGDKLFLDGL VSVWQVDAQ                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page