(data stored in ACNUC7421 zone)

EMBL: CP001389.THRB

CP001389.THRB        Location/Qualifiers
FT   CDS             588209..589189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="NGR_c05340"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24330"
FT                   /db_xref="GOA:C3MHK2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHK2"
FT                   /protein_id="ACP24330.1"
FT                   /translation="MAVYTDITEDELAGFLAAYDVGTLTSYKGIAEGVENSNFLLHTTR
FT                   GSYILTLYEKRVNADDLPFFLGLMHHLAERGLSCPLPLPRADGALLGTLSGRPAAVISF
FT                   LEGMWLRKPEAQHCREVGRALASMHEAGEGFALTRANALSVGGWRPLWRNSEARADEVQ
FT                   DGLKEDIAAELAYLEDHWPRNLPQGVIHADLFPDNVFFLGDRLSGLIDFYFACNDFLAY
FT                   DIAVCLNSWCFEKNGSYNITKGMALLSGYESVRKLTAEEVSALPLLARGSALRFFLTRL
FT                   YDWLMTPAGALVVKKDPLEYLTKLRFHRAVVSSAEYGLRRDEASQ"
     MAVYTDITED ELAGFLAAYD VGTLTSYKGI AEGVENSNFL LHTTRGSYIL TLYEKRVNAD        60
     DLPFFLGLMH HLAERGLSCP LPLPRADGAL LGTLSGRPAA VISFLEGMWL RKPEAQHCRE       120
     VGRALASMHE AGEGFALTRA NALSVGGWRP LWRNSEARAD EVQDGLKEDI AAELAYLEDH       180
     WPRNLPQGVI HADLFPDNVF FLGDRLSGLI DFYFACNDFL AYDIAVCLNS WCFEKNGSYN       240
     ITKGMALLSG YESVRKLTAE EVSALPLLAR GSALRFFLTR LYDWLMTPAG ALVVKKDPLE       300
     YLTKLRFHRA VVSSAEYGLR RDEASQ                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page