(data stored in ACNUC7421 zone)

EMBL: CP001389.THRC

CP001389.THRC        Location/Qualifiers
FT   CDS             complement(598467..599864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="NGR_c05430"
FT                   /product="threonine synthetase protein"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24339"
FT                   /db_xref="GOA:C3MHL1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL1"
FT                   /protein_id="ACP24339.1"
FT                   /translation="MKYISTRGEAAPLGFCDALLAGLARDGGLYLPKEWPTFSKKEIRA
FT                   LRGKSYQEIAFTVLQPFTNGEIPAAKFREMIDGAYATFRHPAIAPLVQTGPNAFVMELF
FT                   HGSTLAFKDVAMQLLARLMDHVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFIL
FT                   FPHGKVSPVQQRQMTTANASNVHAIAVNGNFDDCQNLVKAMFNDTAFRDRVKLSGVNSI
FT                   NWARIMAQIVYYFTTAIALGGPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATN
FT                   ENDILARTLKTGRYEMREVKATTSPSMDIQISSNFERLLFEAFGREASEVRAAMASLKQ
FT                   SGSFAIEEGALKKIRKEFRAGRASEKQVAATIRDTFKKSGYLLDPHTAIGVSVAAKHEK
FT                   PSAPMVVLGTAHPAKFPDAVKSASGIDPTLPTWLADLMTRAERFDILDAELKNVETFIG
FT                   ERTRVQK"
     MKYISTRGEA APLGFCDALL AGLARDGGLY LPKEWPTFSK KEIRALRGKS YQEIAFTVLQ        60
     PFTNGEIPAA KFREMIDGAY ATFRHPAIAP LVQTGPNAFV MELFHGSTLA FKDVAMQLLA       120
     RLMDHVLAER GERATIVGAT SGDTGGAAID AFAGRDRTDI FILFPHGKVS PVQQRQMTTA       180
     NASNVHAIAV NGNFDDCQNL VKAMFNDTAF RDRVKLSGVN SINWARIMAQ IVYYFTTAIA       240
     LGGPDRKISF TVPTGNFGDI FAGYVAKRMG LPIDKLIIAT NENDILARTL KTGRYEMREV       300
     KATTSPSMDI QISSNFERLL FEAFGREASE VRAAMASLKQ SGSFAIEEGA LKKIRKEFRA       360
     GRASEKQVAA TIRDTFKKSG YLLDPHTAIG VSVAAKHEKP SAPMVVLGTA HPAKFPDAVK       420
     SASGIDPTLP TWLADLMTRA ERFDILDAEL KNVETFIGER TRVQK                       465
//

If you have problems or comments...

PBIL Back to PBIL home page