(data stored in ACNUC7421 zone)

EMBL: CP001389.XSEB

CP001389.XSEB        Location/Qualifiers
FT   CDS             complement(556026..556280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="NGR_c04980"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24294"
FT                   /db_xref="GOA:C3MHG6"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG6"
FT                   /protein_id="ACP24294.1"
FT                   /translation="MNNNNTQPDVSALSFEQAVEELERIVSALERGDVALDKSIEIYER
FT                   GEALKKHCETLLKAAEDRIEKIRLDRNGKPQAVEPLDAE"
     MNNNNTQPDV SALSFEQAVE ELERIVSALE RGDVALDKSI EIYERGEALK KHCETLLKAA        60
     EDRIEKIRLD RNGKPQAVEP LDAE                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page