(data stored in SCRATCH3701 zone)

EMBL: CP001396.ACPH

CP001396.ACPH        Location/Qualifiers
FT   CDS             complement(326320..326901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="BWG_0286"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0404"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62270"
FT                   /db_xref="GOA:C4ZTG1"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZTG1"
FT                   /protein_id="ACR62270.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYDALETRFWQFYPRMMAQASRKAL"
     MNFLAHLHLA HLAESSLSGN LLADFVRGNP EESFPPDVVA GIHMHRRIDV LTDNLPEVRE        60
     AREWFRSETR RVAPITLDVM WDHFLSRHWS QLSPDFPLQE FVCYAREQVM TILPDSPPRF       120
     INLNNYLWSE QWLVRYRDMD FIQNVLNGMA SRRPRLDALR DSWYDLDAHY DALETRFWQF       180
     YPRMMAQASR KAL                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page