(data stored in SCRATCH3701 zone)

EMBL: CP001396.ADK

CP001396.ADK         Location/Qualifiers
FT   CDS             399158..399802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BWG_0355"
FT                   /product="adenylate kinase"
FT                   /note="MG1655 equivalent: b0474"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR61932"
FT                   /db_xref="GOA:C4ZUS8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZUS8"
FT                   /protein_id="ACR61932.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG"
     MRIILLGAPG AGKGTQAQFI MEKYGIPQIS TGDMLRAAVK SGSELGKQAK DIMDAGKLVT        60
     DELVIALVKE RIAQEDCRNG FLLDGFPRTI PQADAMKEAG INVDYVLEFD VPDELIVDRI       120
     VGRRVHAPSG RVYHVKFNPP KVEGKDDVTG EELTTRKDDQ EETVRKRLVE YHQMTAPLIG       180
     YYSKEAEAGN TKYAKVDGTK PVAEVRADLE KILG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page