(data stored in SCRATCH3701 zone)

EMBL: CP001396.ARTJ

CP001396.ARTJ        Location/Qualifiers
FT   CDS             complement(802035..802766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artJ"
FT                   /locus_tag="BWG_0713"
FT                   /product="arginine transporter subunit"
FT                   /note="MG1655 equivalent: b0860"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62004"
FT                   /protein_id="ACR62004.1"
FT                   /translation="MKKLVLAALLASFTFGASAAEKINFGVSATYPPFESIGANNEIVG
FT                   FDIDLAKALCKQMQAECTFTNHAFDSLIPSLKFRKYDAVISGMDITPERSKQVSFTTPY
FT                   YENSAVVIAKKDTYKTFADLKGKRIGMENGTTHQKYIQDQHPEVKTVSYDSYQNAFIDL
FT                   KNGRIDGVFGDTAVVNEWLKTNPQLGVATEKVTDPQYFGTGLGIAVRPDNKALLEKLNN
FT                   ALAAIKADGTYQKISDQWFPQ"
     MKKLVLAALL ASFTFGASAA EKINFGVSAT YPPFESIGAN NEIVGFDIDL AKALCKQMQA        60
     ECTFTNHAFD SLIPSLKFRK YDAVISGMDI TPERSKQVSF TTPYYENSAV VIAKKDTYKT       120
     FADLKGKRIG MENGTTHQKY IQDQHPEVKT VSYDSYQNAF IDLKNGRIDG VFGDTAVVNE       180
     WLKTNPQLGV ATEKVTDPQY FGTGLGIAVR PDNKALLEKL NNALAAIKAD GTYQKISDQW       240
     FPQ                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page