(data stored in SCRATCH3701 zone)

EMBL: CP001396.CMR

CP001396.CMR         Location/Qualifiers
FT   CDS             785864..787096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmr"
FT                   /locus_tag="BWG_0695"
FT                   /product="multidrug efflux system protein"
FT                   /note="MG1655 equivalent: b0842"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63810"
FT                   /protein_id="ACR63810.1"
FT                   /translation="MQNKLASGARLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVE
FT                   QYQAGIDWVPTSMTAYLAGGMFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQN
FT                   IEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAA
FT                   WIHVLPWEGMFVLFAALAAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFV
FT                   AGALALGFVSLPLLAWIAQSPIIIITGEQLSSYEYGLLQVPIFGALIAGNLLLARLTSR
FT                   RTVRSLIIMGGWPIMIGLLVAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLF
FT                   ASDMSKGTVSAAMGMLQMLIFTVGIEISKHAWLNGGNGLFNLFNLVNGILWLSLMVIFL
FT                   KDKQMGNSHEG"
     MQNKLASGAR LGRQALLFPL CLVLYEFSTY IGNDMIQPGM LAVVEQYQAG IDWVPTSMTA        60
     YLAGGMFLQW LLGPLSDRIG RRPVMLAGVV WFIVTCLAIL LAQNIEQFTL LRFLQGISLC       120
     FIGAVGYAAI QESFEEAVCI KITALMANVA LIAPLLGPLV GAAWIHVLPW EGMFVLFAAL       180
     AAISFFGLQR AMPETATRIG EKLSLKELGR DYKLVLKNGR FVAGALALGF VSLPLLAWIA       240
     QSPIIIITGE QLSSYEYGLL QVPIFGALIA GNLLLARLTS RRTVRSLIIM GGWPIMIGLL       300
     VAAAATVISS HAYLWMTAGL SIYAFGIGLA NAGLVRLTLF ASDMSKGTVS AAMGMLQMLI       360
     FTVGIEISKH AWLNGGNGLF NLFNLVNGIL WLSLMVIFLK DKQMGNSHEG                  410
//

If you have problems or comments...

PBIL Back to PBIL home page