(data stored in SCRATCH3701 zone)

EMBL: CP001396.CRCB

CP001396.CRCB        Location/Qualifiers
FT   CDS             complement(559538..559921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="BWG_0497"
FT                   /product="predicted inner membrane protein associated with
FT                   chromosome condensation"
FT                   /note="MG1655 equivalent: b0624"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64583"
FT                   /db_xref="GOA:C4ZWB3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZWB3"
FT                   /protein_id="ACR64583.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGA
FT                   FIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     MLQLLLAVFI GGGTGSVARW LLSMRFNPLH QAIPLGTLTA NLIGAFIIGI GFAWFSRMTN        60
     IDPVWKVLIT TGFCGGLTTF STFSAEVVFL LQEGRFGWAL LNVFVNLLGS FAMTALAFWL       120
     FSASTAH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page