(data stored in SCRATCH3701 zone)

EMBL: CP001396.FTSA

CP001396.FTSA        Location/Qualifiers
FT   CDS             103981..105243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="BWG_0089"
FT                   /product="ATP-binding cell division protein involved in
FT                   recruitment of FtsK to Z ring"
FT                   /note="MG1655 equivalent: b0094"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62037"
FT                   /protein_id="ACR62037.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
     MIKATDRKLV VGLEIGTAKV AALVGEVLPD GMVNIIGVGS CPSRGMDKGG VNDLESVVKC        60
     VQRAIDQAEL MADCQISSVY LALSGKHISC QNEIGMVPIS EEEVTQEDVE NVVHTAKSVR       120
     VRDEHRVLHV IPQEYAIDYQ EGIKNPVGLS GVRMQAKVHL ITCHNDMAKN IVKAVERCGL       180
     KVDQLIFAGL ASSYSVLTED ERELGVCVVD IGGGTMDIAV YTGGALRHTK VIPYAGNVVT       240
     SDIAYAFGTP PSDAEAIKVR HGCALGSIVG KDESVEVPSV GGRPPRSLQR QTLAEVIEPR       300
     YTELLNLVNE EILQLQEKLR QQGVKHHLAA GIVLTGGAAQ IEGLAACAQR VFHTQVRIGA       360
     PLNITGLTDY AQEPYYSTAV GLLHYGKESH LNGEAEVEKR VTASVGSWIK RLNSWLRKEF       420
//

If you have problems or comments...

PBIL Back to PBIL home page