(data stored in SCRATCH3701 zone)

EMBL: CP001396.FTSQ

CP001396.FTSQ        Location/Qualifiers
FT   CDS             103154..103984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="BWG_0088"
FT                   /product="membrane anchored protein involved in growth of
FT                   wall at septum"
FT                   /note="MG1655 equivalent: b0093"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63732"
FT                   /protein_id="ACR63732.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
     MSQAALNTRN SEEEVSSRRN NGTRLAGILF LLTVLTTVLV SGWVVLGWME DAQRLPLSKL        60
     VLTGERHYTR NDDIRQSILA LGEPGTFMTQ DVNIIQTQIE QRLPWIKQVS VRKQWPDELK       120
     IHLVEYVPIA RWNDQHMVDA EGNTFSVPPE RTSKQVLPML YGPEGSANEV LQGYREMGQM       180
     LAKDRFTLKE AAMTARRSWQ LTLNNDIKLN LGRGDTMKRL ARFVELYPVL QQQAQTDGKR       240
     ISYVDLRYDS GAAVGWAPLP PEESTQQQNQ AQAEQQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page