(data stored in SCRATCH3701 zone)

EMBL: CP001396.GLNK

CP001396.GLNK        Location/Qualifiers
FT   CDS             374581..374919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="BWG_0332"
FT                   /product="nitrogen assimilation regulatory protein for
FT                   GlnL, GlnE, and AmtB"
FT                   /note="MG1655 equivalent: b0450"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63913"
FT                   /protein_id="ACR63913.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
     MKLVTVIIKP FKLEDVREAL SSIGIQGLTV TEVKGFGRQK GHAELYRGAE YSVNFLPKVK        60
     IDVAIADDQL DEVIDIVSKA AYTGKIGDGK IFVAELQRVI RIRTGEADEA AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page