(data stored in SCRATCH3701 zone)

EMBL: CP001396.GLNQ

CP001396.GLNQ        Location/Qualifiers
FT   CDS             complement(747932..748654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="BWG_0662"
FT                   /product="glutamine transporter subunit"
FT                   /note="MG1655 equivalent: b0809"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63337"
FT                   /protein_id="ACR63337.1"
FT                   /translation="MIEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLR
FT                   CINKLEEITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLR
FT                   VRGANKEEAEKLARELLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEP
FT                   TSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGNPQV
FT                   LIKNPPSQRLQEFLQHVS"
     MIEFKNVSKH FGPTQVLHNI DLNIAQGEVV VIIGPSGSGK STLLRCINKL EEITSGDLIV        60
     DGLKVNDPKV DERLIRQEAG MVFQQFYLFP HLTALENVMF GPLRVRGANK EEAEKLAREL       120
     LAKVGLAERA HHYPSELSGG QQQRVAIARA LAVKPKMMLF DEPTSALDPE LRHEVLKVMQ       180
     DLAEEGMTMV IVTHEIGFAE KVASRLIFID KGRIAEDGNP QVLIKNPPSQ RLQEFLQHVS       240
//

If you have problems or comments...

PBIL Back to PBIL home page