(data stored in SCRATCH3701 zone)

EMBL: CP001396.GLTL

CP001396.GLTL        Location/Qualifiers
FT   CDS             complement(586513..587238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="BWG_0523"
FT                   /product="glutamate and aspartate transporter subunit"
FT                   /note="MG1655 equivalent: b0652"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63323"
FT                   /protein_id="ACR63323.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
     MITLKNVSKW YGHFQVLTDC STEVKKGEVV VVCGPSGSGK STLIKTVNGL EPVQQGEITV        60
     DGIVVNDKKT DLAKLRSRVG MVFQHFELFP HLSIIENLTL AQVKVLKRDK APAREKALKL       120
     LERVGLSAHA NKFPAQLSGG QQQRVAIARA LCMDPIAMLF DEPTSALDPE MINEVLDVMV       180
     ELANEGMTMM VVTHEMGFAR KVANRVIFMD EGKIVEDSPK DAFFDDPKSD RAKDFLAKIL       240
     H                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page