(data stored in SCRATCH3701 zone)

EMBL: CP001396.GSIA

CP001396.GSIA        Location/Qualifiers
FT   CDS             769711..771582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiA"
FT                   /locus_tag="BWG_0682"
FT                   /product="fused predicted peptide transport subunits of ABC
FT                   superfamily: ATP-binding components"
FT                   /note="MG1655 equivalent: b0829"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63231"
FT                   /protein_id="ACR63231.1"
FT                   /translation="MPHSDELDAGNVLAVENLNIAFMQDQQKIAAVRNLSFSLQRGETL
FT                   AIVGESGSGKSVTALALMRLLEQAGGLVQCDKMLLQRRSREVIELSEQNAAQMRHVRGA
FT                   DMAMIFQEPMTSLNPVFTVGEQIAESIRLHQNASREEAMVEAKRMLDQVRIPEAQTILS
FT                   RYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQKEMSMGV
FT                   IFITHDMGVVAEIADRVLVMYQGEAVETGTVEQIFHAPQHPYTRALLAAVPQLGAMKGL
FT                   DYPRRFPLISLEHPAKQAPPIEQKTVVDGEPVLRVRNLVTRFPLRSGLLNRVTREVHAV
FT                   EKVSFDLWPGETLSLVGESGSGKSTTGRALLRLVESQGGEIIFNGQRIDTLSPGKLQAL
FT                   RRDIQFIFQDPYASLDPRQTIGDSIIEPLRVHGLLPGKDAAARVAWLLERVGLLPEHAW
FT                   RYPHEFSGGQRQRICIARALALNPKVIIADEAVSALDVSIRGQIINLLLDLQRDFGIAY
FT                   LFISHDMAVVERISHRVAVMYLGQIVEIGPRRAVFENPQHPYTRKLLAAVPVAEPSRQR
FT                   PQRVLLSDDLPSNIHLRGEEVAAVSLQCVGPGHYVAQPQSEYAFMRR"
     MPHSDELDAG NVLAVENLNI AFMQDQQKIA AVRNLSFSLQ RGETLAIVGE SGSGKSVTAL        60
     ALMRLLEQAG GLVQCDKMLL QRRSREVIEL SEQNAAQMRH VRGADMAMIF QEPMTSLNPV       120
     FTVGEQIAES IRLHQNASRE EAMVEAKRML DQVRIPEAQT ILSRYPHQLS GGMRQRVMIA       180
     MALSCRPAVL IADEPTTALD VTIQAQILQL IKVLQKEMSM GVIFITHDMG VVAEIADRVL       240
     VMYQGEAVET GTVEQIFHAP QHPYTRALLA AVPQLGAMKG LDYPRRFPLI SLEHPAKQAP       300
     PIEQKTVVDG EPVLRVRNLV TRFPLRSGLL NRVTREVHAV EKVSFDLWPG ETLSLVGESG       360
     SGKSTTGRAL LRLVESQGGE IIFNGQRIDT LSPGKLQALR RDIQFIFQDP YASLDPRQTI       420
     GDSIIEPLRV HGLLPGKDAA ARVAWLLERV GLLPEHAWRY PHEFSGGQRQ RICIARALAL       480
     NPKVIIADEA VSALDVSIRG QIINLLLDLQ RDFGIAYLFI SHDMAVVERI SHRVAVMYLG       540
     QIVEIGPRRA VFENPQHPYT RKLLAAVPVA EPSRQRPQRV LLSDDLPSNI HLRGEEVAAV       600
     SLQCVGPGHY VAQPQSEYAF MRR                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page