(data stored in SCRATCH3701 zone)

EMBL: CP001396.GSIB

CP001396.GSIB        Location/Qualifiers
FT   CDS             771602..773140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /locus_tag="BWG_0683"
FT                   /product="predicted peptide transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /note="MG1655 equivalent: b0830"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64803"
FT                   /protein_id="ACR64803.1"
FT                   /translation="MARAVHRSGLVALGIATALMASCAFAAKDVVVAVGSNFTTLDPYD
FT                   ANDTLSQAVAKSFYQGLFGLDKEMKLKNVLAESYTVSDDGITYTVKLREGIKFQDGTDF
FT                   NAAAVKANLDRASDPANHLKRYNLYKNIAKTEAIDPTTVKITLKQPFSAFINILAHPAT
FT                   AMISPAALEKYGKEIGFYPVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSITWRP
FT                   VADNNTRAAMLQTGEAQFAFPIPYEQATLLEKNKNIELMASPSIMQRYISMNVTQKPFD
FT                   NPKVREALNYAINRPALVKVAFAGYATPATGVVPPSIAYAQSYKPWPYDPVKARELLKE
FT                   AGYPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVTAMDAGQRAAEVEGKGQKE
FT                   SGVRMFYTGWSASTGEADWALSPLFASQNWPPTLFNTAFYSNKQVDDFLAQALKTNDPA
FT                   EKTRLYKAAQDIIWQESPWIPLVVEKLVSAHSKNLTGFWIMPDTGFSFEDADLQ"
     MARAVHRSGL VALGIATALM ASCAFAAKDV VVAVGSNFTT LDPYDANDTL SQAVAKSFYQ        60
     GLFGLDKEMK LKNVLAESYT VSDDGITYTV KLREGIKFQD GTDFNAAAVK ANLDRASDPA       120
     NHLKRYNLYK NIAKTEAIDP TTVKITLKQP FSAFINILAH PATAMISPAA LEKYGKEIGF       180
     YPVGTGPYEL DTWNQTDFVK VKKFAGYWQP GLPKLDSITW RPVADNNTRA AMLQTGEAQF       240
     AFPIPYEQAT LLEKNKNIEL MASPSIMQRY ISMNVTQKPF DNPKVREALN YAINRPALVK       300
     VAFAGYATPA TGVVPPSIAY AQSYKPWPYD PVKARELLKE AGYPNGFSTT LWSSHNHSTA       360
     QKVLQFTQQQ LAQVGIKAQV TAMDAGQRAA EVEGKGQKES GVRMFYTGWS ASTGEADWAL       420
     SPLFASQNWP PTLFNTAFYS NKQVDDFLAQ ALKTNDPAEK TRLYKAAQDI IWQESPWIPL       480
     VVEKLVSAHS KNLTGFWIMP DTGFSFEDAD LQ                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page