(data stored in SCRATCH3701 zone)

EMBL: CP001396.GSID

CP001396.GSID        Location/Qualifiers
FT   CDS             774081..774992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiD"
FT                   /locus_tag="BWG_0685"
FT                   /product="predicted peptide transporter subunit: membrane
FT                   component of ABC superfamily"
FT                   /note="MG1655 equivalent: b0832"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64802"
FT                   /protein_id="ACR64802.1"
FT                   /translation="MRLFNWRRQAVLNAMPLVKPDQVRTPWHEFWRRFRRQHMAMTAAL
FT                   FVILLIVVAIFARWIAPYDAENYFDYDNLNNGPSLQHWFGVDSLGRDIFSRVLVGAQIS
FT                   LAAGVFAVFIGAAIGTLLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSG
FT                   IANVIIAVAIFSIPAFARLVRGNTLVLKQQTFIESARSIGASDMTVLLRHILPGTVSSI
FT                   VVFFTMRIGTSIISAASLSFLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFL
FT                   TVLAFNLLGDGLRDALDPKIKG"
     MRLFNWRRQA VLNAMPLVKP DQVRTPWHEF WRRFRRQHMA MTAALFVILL IVVAIFARWI        60
     APYDAENYFD YDNLNNGPSL QHWFGVDSLG RDIFSRVLVG AQISLAAGVF AVFIGAAIGT       120
     LLGLLAGYYE GWWDRLIMRI CDVLFAFPGI LLAIAVVAVL GSGIANVIIA VAIFSIPAFA       180
     RLVRGNTLVL KQQTFIESAR SIGASDMTVL LRHILPGTVS SIVVFFTMRI GTSIISAASL       240
     SFLGLGAQPP TPEWGAMLNE ARADMVIAPH VAVFPALAIF LTVLAFNLLG DGLRDALDPK       300
     IKG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page