(data stored in SCRATCH3701 zone)

EMBL: CP001396.ILVH

CP001396.ILVH        Location/Qualifiers
FT   CDS             87356..87847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="BWG_0074"
FT                   /product="acetolactate synthase III, thiamin-dependent,
FT                   small subunit"
FT                   /note="MG1655 equivalent: b0078"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR61903"
FT                   /protein_id="ACR61903.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     MRRILSVLLE NESGALSRVI GLFSQRGYNI ESLTVAPTDD PTLSRMTIQT VGDEKVLEQI        60
     EKQLHKLVDV LRVSELGQGA HVEREIMLVK IQASGYGRDE VKRNTEIFRG QIIDVTPSLY       120
     TVQLAGTSGK LDAFLASIRD VAKIVEVARS GVVGLSRGDK IMR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page