(data stored in SCRATCH3701 zone)

EMBL: CP001396.INSA

CP001396.INSA        Location/Qualifiers
FT   CDS             complement(20233..20508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="BWG_0020"
FT                   /product="KpLE2 phage-like element; IS1 repressor protein
FT                   InsA"
FT                   /note="MG1655 equivalent: b0022"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63576"
FT                   /protein_id="ACR63576.1"
FT                   /translation="MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSGRSR"
     MASVSISCPS CSATDGVVRN GKSTAGHQRY LCSHCRKTWQ LQFTYTASQP GTHQKIIDMA        60
     MNGVGCRATA RIMGVGLNTI LRHLKNSGRS R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page