(data stored in SCRATCH3701 zone)

EMBL: CP001396.INSF

CP001396.INSF        Location/Qualifiers
FT   CDS             complement(293722..294588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insF"
FT                   /locus_tag="BWG_0257"
FT                   /product="IS3 element protein InsF"
FT                   /note="MG1655 equivalent: b0372"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63541"
FT                   /protein_id="ACR63541.1"
FT                   /translation="MKYVFIEKHQAEFSIKAMCRVLRVARSGWYTWCQRRTRISTRQQF
FT                   RQHCDSVVLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRKFSP
FT                   VSYRAHGLPVSENLLEQDFYASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWS
FT                   MSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKG
FT                   CCYDNACVESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQ
FT                   FENKNLA"
     MKYVFIEKHQ AEFSIKAMCR VLRVARSGWY TWCQRRTRIS TRQQFRQHCD SVVLAAFTRS        60
     KQRYGAPRLT DELRAQGYPF NVKTVAASLR RQGLRAKASR KFSPVSYRAH GLPVSENLLE       120
     QDFYASGPNQ KWAGDITYLR TDEGWLYLAV VIDLWSRAVI GWSMSPRMTA QLACDALQMA       180
     LWRRKRPRNV IVHTDRGGQY CSADYQAQLK RHNLRGSMSA KGCCYDNACV ESFFHSLKVE       240
     CIHGEHFISR EIMRATVFNY IECDYNRWRR HSWCGGLSPE QFENKNLA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page