(data stored in SCRATCH3701 zone)

EMBL: CP001396.MOAB

CP001396.MOAB        Location/Qualifiers
FT   CDS             720246..720758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaB"
FT                   /locus_tag="BWG_0635"
FT                   /product="molybdopterin biosynthesis protein B"
FT                   /note="MG1655 equivalent: b0782"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63798"
FT                   /protein_id="ACR63798.1"
FT                   /translation="MSQVSTEFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVV
FT                   DKAIVKENRYAIRAQVSAWIASDDVQVVLITGGTGLTEGDQAPEALLPLFDREVEGFGE
FT                   VFRMLSFEEIGTSTLQSRAVAGVANKTLIFAMPGSTKACRTAWENIIAPQLDARTRPCN
FT                   FHPHLKK"
     MSQVSTEFIP TRIAILTVSN RRGEEDDTSG HYLRDSAQEA GHHVVDKAIV KENRYAIRAQ        60
     VSAWIASDDV QVVLITGGTG LTEGDQAPEA LLPLFDREVE GFGEVFRMLS FEEIGTSTLQ       120
     SRAVAGVANK TLIFAMPGST KACRTAWENI IAPQLDARTR PCNFHPHLKK                  170
//

If you have problems or comments...

PBIL Back to PBIL home page