(data stored in SCRATCH3701 zone)

EMBL: CP001396.MOAC

CP001396.MOAC        Location/Qualifiers
FT   CDS             720761..721246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="BWG_0636"
FT                   /product="molybdopterin biosynthesis, protein C"
FT                   /note="MG1655 equivalent: b0783"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63799"
FT                   /db_xref="GOA:C4ZXV5"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZXV5"
FT                   /protein_id="ACR63799.1"
FT                   /translation="MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMII
FT                   DGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCR
FT                   LTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEADD"
     MSQLTHINAA GEAHMVDVSA KAETVREARA EAFVTMRSET LAMIIDGRHH KGDVFATARI        60
     AGIQAAKRTW DLIPLCHPLM LSKVEVNLQA EPEHNRVRIE TLCRLTGKTG VEMEALTAAS       120
     VAALTIYDMC KAVQKDMVIG PVRLLAKSGG KSGDFKVEAD D                           161
//

If you have problems or comments...

PBIL Back to PBIL home page