(data stored in SCRATCH3701 zone)

EMBL: CP001396.MODB

CP001396.MODB        Location/Qualifiers
FT   CDS             698053..698742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BWG_0616"
FT                   /product="molybdate transporter subunit"
FT                   /note="MG1655 equivalent: b0764"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63793"
FT                   /protein_id="ACR63793.1"
FT                   /translation="MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKA
FT                   LLDSVLHLPLVLPPVVVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSF
FT                   PLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGE
FT                   FGATITFVSNIPGETRTIPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARI
FT                   SRERAGR"
     MILTDPEWQA VLLSLKVSSL AVLFSLPFGI FFAWLLVRCT FPGKALLDSV LHLPLVLPPV        60
     VVGYLLLVSM GRRGFIGERL YDWFGITFAF SWRGAVLAAA VMSFPLMVRA IRLALEGVDV       120
     KLEQAARTLG AGRWRVFFTI TLPLTLPGII VGTVLAFARS LGEFGATITF VSNIPGETRT       180
     IPSAMYTLIQ TPGGESGAAR LCIISIALAM ISLLISEWLA RISRERAGR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page