(data stored in SCRATCH3701 zone)

EMBL: CP001396.MOEA

CP001396.MOEA        Location/Qualifiers
FT   CDS             complement(767320..768555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="BWG_0680"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /note="MG1655 equivalent: b0827"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63796"
FT                   /protein_id="ACR63796.1"
FT                   /translation="MEFTTGLMSLDTALNEMLSRVTPLTAQETLPLVQCFGRILASDVV
FT                   SPLDVPGFDNSAMDGYAVRLADIASGQPLPVAGKSFAGQPYHGEWPAGTCIRIMTGAPV
FT                   PEGCEAVVMQEQTEQMDNGVRFTAEVRSGQNIRRRGEDISAGAVVFPAGTRLTTAELPV
FT                   IASLGIAEVPVIRKVRVALFSTGDELQLPGQPLGDGQIYDTNRLAVHLMLEQLGCEVIN
FT                   LGIIRDDPHALRAAFIEADSQADVVISSGGVSVGEADYTKTILEELGEIAFWKLAIKPG
FT                   KPFAFGKLSNSWFCGLPGNPVSATLTFYQLVQPLLAKLSGNTASGLPARQRVRTASRLK
FT                   KTPGRLDFQRGVLQRNADGELEVTTTGHQGSHIFSSFSLGNCFIVLERDRGNVEVGEWV
FT                   EVEPFNALFGGL"
     MEFTTGLMSL DTALNEMLSR VTPLTAQETL PLVQCFGRIL ASDVVSPLDV PGFDNSAMDG        60
     YAVRLADIAS GQPLPVAGKS FAGQPYHGEW PAGTCIRIMT GAPVPEGCEA VVMQEQTEQM       120
     DNGVRFTAEV RSGQNIRRRG EDISAGAVVF PAGTRLTTAE LPVIASLGIA EVPVIRKVRV       180
     ALFSTGDELQ LPGQPLGDGQ IYDTNRLAVH LMLEQLGCEV INLGIIRDDP HALRAAFIEA       240
     DSQADVVISS GGVSVGEADY TKTILEELGE IAFWKLAIKP GKPFAFGKLS NSWFCGLPGN       300
     PVSATLTFYQ LVQPLLAKLS GNTASGLPAR QRVRTASRLK KTPGRLDFQR GVLQRNADGE       360
     LEVTTTGHQG SHIFSSFSLG NCFIVLERDR GNVEVGEWVE VEPFNALFGG L                411
//

If you have problems or comments...

PBIL Back to PBIL home page