(data stored in SCRATCH3701 zone)

EMBL: CP001396.MRAZ

CP001396.MRAZ        Location/Qualifiers
FT   CDS             89633..90091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="BWG_0076"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0081"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62423"
FT                   /db_xref="GOA:C4ZQ03"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZQ03"
FT                   /protein_id="ACR62423.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
     MFRGATLVNL DSKGRLSVPT RYREQLLENA AGQMVCTIDI HHPCLLLYPL PEWEIIEQKL        60
     SRLSSMNPVE RRVQRLLLGH ASECQMDGAG RLLIAPVLRQ HAGLTKEVML VGQFNKFELW       120
     DETTWHQQVK EDIDAEQLAT GDLSERLQDL SL                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page