(data stored in SCRATCH3701 zone)

EMBL: CP001396.NRDR

CP001396.NRDR        Location/Qualifiers
FT   CDS             334985..335434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="BWG_0295"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0413"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62436"
FT                   /db_xref="GOA:C4ZTH0"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZTH0"
FT                   /protein_id="ACR62436.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
     MHCPFCFAVD TKVIDSRLVG EGSSVRRRRQ CLVCNERFTT FEVAELVMPR VVKSNDVREP        60
     FNEEKLRSGM LRALEKRPVS SDDVEMAINH IKSQLRATGE REVPSKMIGN LVMEQLKKLD       120
     KVAYIRFASV YRSFEDIKEF GEEIARLED                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page