(data stored in SCRATCH3701 zone)

EMBL: CP001396.POTG

CP001396.POTG        Location/Qualifiers
FT   CDS             797182..798315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="BWG_0708"
FT                   /product="putrescine transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /note="MG1655 equivalent: b0855"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACR65337"
FT                   /protein_id="ACR65337.1"
FT                   /translation="MNDAIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKG
FT                   EIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFP
FT                   HMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARS
FT                   LAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAI
FT                   MNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKV
FT                   DADASVVDNVPVHVALRPEKIMLCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQ
FT                   MISAQLQNAHRHRKGLPTWGDEVRLCWEVDSCVVLTV"
     MNDAIPRPQA KTRKALTPLL EIRNLTKSYD GQHAVDDVSL TIYKGEIFAL LGASGCGKST        60
     LLRMLAGFEQ PSAGQIMLDG VDLSQVPPYL RPINMMFQSY ALFPHMTVEQ NIAFGLKQDK       120
     LPKAEIASRV NEMLGLVHMQ EFAKRKPHQL SGGQRQRVAL ARSLAKRPKL LLLDEPMGAL       180
     DKKLRDRMQL EVVDILERVG VTCVMVTHDQ EEAMTMAGRI AIMNRGKFVQ IGEPEEIYEH       240
     PTTRYSAEFI GSVNVFEGVL KERQEDGLVL DSPGLVHPLK VDADASVVDN VPVHVALRPE       300
     KIMLCEEPPA NGCNFAVGEV IHIAYLGDLS VYHVRLKSGQ MISAQLQNAH RHRKGLPTWG       360
     DEVRLCWEVD SCVVLTV                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page