(data stored in SCRATCH3701 zone)

EMBL: CP001396.PPDD

CP001396.PPDD        Location/Qualifiers
FT   CDS             complement(117108..117548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="BWG_0101"
FT                   /product="predicted major pilin subunit"
FT                   /note="MG1655 equivalent: b0108"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64639"
FT                   /protein_id="ACR64639.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWTRNCNIQSDSALQQACEDVFRFDDAN"
     MDKQRGFTLI ELMVVIGIIA ILSAIGIPAY QNYLRKAALT DMLQTFVPYR TAVELCALEH        60
     GGLDTCDGGS NGIPSPTTTR YVSAMSVAKG VVSLTGQESL NGLSVVMTPG WDNANGVTGW       120
     TRNCNIQSDS ALQQACEDVF RFDDAN                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page