(data stored in SCRATCH3701 zone)

EMBL: CP001396.RCSF

CP001396.RCSF        Location/Qualifiers
FT   CDS             complement(219590..219994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="BWG_0189"
FT                   /product="predicted outer membrane protein, signal"
FT                   /note="MG1655 equivalent: b0196"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64725"
FT                   /protein_id="ACR64725.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQAVCIGSALNITAK"
     MRALPICLVA LMLSGCSMLS RSPVEPVQST APQPKAEPAK PKAPRATPVR IYTNAEELVG        60
     KPFRDLGEVS GDSCQASNQD SPPSIPTARK RMQINASKMK ANAVLLHSCE VTSGTPGCYR       120
     QAVCIGSALN ITAK                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page