(data stored in SCRATCH3701 zone)

EMBL: CP001396.RPST

CP001396.RPST        Location/Qualifiers
FT   CDS             complement(20815..21078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="BWG_0021"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /note="MG1655 equivalent: b0023"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR61793"
FT                   /db_xref="GOA:C4ZPU9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZPU9"
FT                   /protein_id="ACR61793.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     MANIKSAKKR AIQSEKARKH NASRRSMMRT FIKKVYAAIE AGDKAAAQKA FNEMQPIVDR        60
     QAAKGLIHKN KAARHKANLT AQINKLA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page