(data stored in SCRATCH3701 zone)

EMBL: CP001396.TOLB

CP001396.TOLB        Location/Qualifiers
FT   CDS             679723..681015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="BWG_0599"
FT                   /product="periplasmic protein"
FT                   /note="MG1655 equivalent: b0740"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64002"
FT                   /db_xref="GOA:C4ZWL5"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZWL5"
FT                   /protein_id="ACR64002.1"
FT                   /translation="MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWA
FT                   GPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQV
FT                   TPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAF
FT                   RTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESG
FT                   RSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIR
FT                   QVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVS
FT                   SDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGS
FT                   VLNLVSTDGRFKARLPATDGQVKFPAWSPYL"
     MKQALRVAFG FLILWASVLH AEVRIVIDSG VDSGRPIGVV PFQWAGPGAA PEDIGGIVAA        60
     DLRNSGKFNP LDRARLPQQP GSAQEVQPAA WSALGIDAVV VGQVTPNPDG SYNVAYQLVD       120
     TGGAPGTVLA QNSYKVNKQW LRYAGHTASD EVFEKLTGIK GAFRTRIAYV VQTNGGQFPY       180
     ELRVSDYDGY NQFVVHRSPQ PLMSPAWSPD GSKLAYVTFE SGRSALVIQT LANGAVRQVA       240
     SFPRHNGAPA FSPDGSKLAF ALSKTGSLNL YVMDLASGQI RQVTDGRSNN TEPTWFPDSQ       300
     NLAFTSDQAG RPQVYKVNIN GGAPQRITWE GSQNQDADVS SDGKFMVMVS SNGGQQHIAK       360
     QDLATGGVQV LSSTFLDETP SLAPNGTMVI YSSSQGMGSV LNLVSTDGRF KARLPATDGQ       420
     VKFPAWSPYL                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page