(data stored in SCRATCH3701 zone)

EMBL: CP001396.YABI

CP001396.YABI        Location/Qualifiers
FT   CDS             71350..72114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="BWG_0061"
FT                   /product="conserved inner membrane protein"
FT                   /note="MG1655 equivalent: b0065"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62207"
FT                   /protein_id="ACR62207.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFVWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLIRHPLMPVYIDILRKVVGV"
     MQALLEHFIT QSTVYSLMAV VLVAFLESLA LVGLILPGTV LMAGLGALIG SGELSFWHAW        60
     LAGIVGCLLG DWISFWLGWR FKKPLHRWSF LKKNKALLDK TEHALHQHSM FTILVGRFVG       120
     PTRPLVPMVA GMLDLPVAKF ITPNIIGCLL WPPFYFLPGI LAGAAIDIPA GMQSGEFKWL       180
     LLATAVFVWV GGWLCWRLWR SGKATDRLSH YLSRGRLLWL TPLISAIGVV ALVVLIRHPL       240
     MPVYIDILRK VVGV                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page