(data stored in SCRATCH3701 zone)

EMBL: CP001396.YACC

CP001396.YACC        Location/Qualifiers
FT   CDS             complement(136569..136916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="BWG_0115"
FT                   /product="predicted protein"
FT                   /note="MG1655 equivalent: b0122"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64843"
FT                   /protein_id="ACR64843.1"
FT                   /translation="MKTFFRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
     MKTFFRTVLF GSLMAVCANS YALSESEAED MADLTAVFVF LKNDCGYQNL PNGQIRRALV        60
     FFAQQNQWDL SNYDTFDMKA LGEDSYRDLS GIGIPVAKKC KALARDSLSL LAYVK            115
//

If you have problems or comments...

PBIL Back to PBIL home page