(data stored in SCRATCH3701 zone)

EMBL: CP001396.YACF

CP001396.YACF        Location/Qualifiers
FT   CDS             complement(111855..112598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="BWG_0096"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0102"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62265"
FT                   /db_xref="GOA:C4ZRJ6"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZRJ6"
FT                   /protein_id="ACR62265.1"
FT                   /translation="MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFR
FT                   NVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNP
FT                   LTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRF
FT                   AIRFMPLDTENGQVPERLDFELACC"
     MQTQVLFEHP LNEKMRTWLR IEFLIQQLTV NLPIVDHAGA LHFFRNVSEL LDVFERGEVR        60
     TELLKELDRQ QRKLQTWIGV PGVDQSRIEA LIQQLKAAGS VLISAPRIGQ FLREDRLIAL       120
     VRQRLSIPGG CCSFDLPTLH IWLHLPQAQR DSQVETWIAS LNPLTQALTM VLDLIRQSAP       180
     FRKQTSLNGF YQDNGGDADL LRLNLSLDSQ LYPQISGHKS RFAIRFMPLD TENGQVPERL       240
     DFELACC                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page