(data stored in SCRATCH3701 zone)

EMBL: CP001396.YADH

CP001396.YADH        Location/Qualifiers
FT   CDS             143701..144471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="BWG_0121"
FT                   /product="predicted transporter subunit: membrane component
FT                   of ABC superfamily"
FT                   /note="MG1655 equivalent: b0128"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR65242"
FT                   /protein_id="ACR65242.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
     MMHLYWVALK SIWAKEIHRF MRIWVQTLVP PVITMTLYFI IFGNLIGSRI GDMHGFSYMQ        60
     FIVPGLIMMS VITNAYANVA SSFFGAKFQR NIEELLVAPV PTHVIIAGYV GGGVARGLFV       120
     GILVTAISLF FVPFQVHSWV FVALTLVLTA VLFSLAGLLN GVFAKTFDDI SLVPTFVLTP       180
     LTYLGGVFYS LTLLPPFWQG LSHLNPIVYM ISGFRYGFLG INDVPLVTTF GVLVVFIVAF       240
     YLICWSLIQR GRGLRS                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page