(data stored in SCRATCH3701 zone)

EMBL: CP001396.YADK

CP001396.YADK        Location/Qualifiers
FT   CDS             complement(151002..151598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="BWG_0129"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /note="MG1655 equivalent: b0136"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64385"
FT                   /protein_id="ACR64385.1"
FT                   /translation="MHPTQRKLMKRIILFLSLLFCIACPAIAGQDIDLVANVKNSTCKS
FT                   GISNQGNIDLGVVGVGYFSGNVTPESYQPGGKEFTITVSDCALQGTGDVLNQLHIDFRA
FT                   LSGVMAAGSRQIFANEISSGASNVGVVIFSTQDSANTFNVLNASGGSRSVYPVMSDDMN
FT                   GSSWKFSTRMQKIDPALSVTSGQLMSHVLVDIYYE"
     MHPTQRKLMK RIILFLSLLF CIACPAIAGQ DIDLVANVKN STCKSGISNQ GNIDLGVVGV        60
     GYFSGNVTPE SYQPGGKEFT ITVSDCALQG TGDVLNQLHI DFRALSGVMA AGSRQIFANE       120
     ISSGASNVGV VIFSTQDSAN TFNVLNASGG SRSVYPVMSD DMNGSSWKFS TRMQKIDPAL       180
     SVTSGQLMSH VLVDIYYE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page