(data stored in SCRATCH3701 zone)

EMBL: CP001396.YAEP

CP001396.YAEP        Location/Qualifiers
FT   CDS             complement(213924..214124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="BWG_0182"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b4406"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62417"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZRT2"
FT                   /protein_id="ACR62417.1"
FT                   /translation="MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSE
FT                   AVREKAAYAAANLLVSDYVNE"
     MEKYCELIRK RYAEIASGDL GYVPDALGCV LKVLNEMAAD DALSEAVREK AAYAAANLLV        60
     SDYVNE                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page